DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnai3

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001011471.1 Gene:gnai3 / 496962 XenbaseID:XB-GENE-5738634 Length:354 Species:Xenopus tropicalis


Alignment Length:372 Identity:132/372 - (35%)
Similarity:208/372 - (55%) Gaps:39/372 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHESI 95
            :|.::.:|..|..::  ||:||||..||||:||:|||:|:|.:|::::|.|:....:|.|..:||
 Frog    19 IDRNLREDGEKASKE--VKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYKVVVYSNTIQSI 81

  Fly    96 LQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPE-YMNEEYCDHVTTLWNDVGIRACYDRSNEF 159
            :.::..||.|.||||.......|..:..|..||.| .|:.|....:..||.|.|::||:.||.|:
 Frog    82 IAIIRAMGRLRIDFGDVARADDARQLFVLASSAEEGVMSPELAGVIQRLWEDPGVQACFSRSREY 146

  Fly   160 PLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGI--SQITFRVPIPKSMGGGEQQFQMYDV 222
            .|.|||.|:|::..||:...|||:.:|:|.:|..||||  :..||:          :..|:|:||
 Frog   147 QLNDSASYYLNDIERIAQVNYIPTQQDVLRTRVKTTGIVETHFTFK----------DLYFKMFDV 201

  Fly   223 GGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLASAGLIV 287
            ||||.:|.|||..|||:.|::|.::.|::|..|.||...||:.|::|||.::..|::.....:|:
 Frog   202 GGQRSERKKWIHCFEGVTAIIFCVALSDYDLLLAEDEEMNRMHESMKLFDSICNNKWFIDTSIIL 266

  Fly   288 FLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPFKRHSR 352
            ||||.|:.|.||......:.| |||..       .|.:.|:   ..:|:.:..|:.:.       
 Frog   267 FLNKKDLFEEKISRSPLTICY-PEYSG-------SNTYEEA---AAYIQCQFEDLNRR------- 313

  Fly   353 NQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGLF 399
                  ...:|.|.|||.||||:.::.||..|..:|:..|:...||:
 Frog   314 ------KDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKSNLMECGLY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 130/368 (35%)
G-alpha 48..392 CDD:206639 126/346 (36%)
gnai3NP_001011471.1 G-alpha 34..348 CDD:206639 126/347 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.