DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gna11b

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001007774.1 Gene:gna11b / 493613 ZFINID:ZDB-GENE-041121-9 Length:359 Species:Danio rerio


Alignment Length:394 Identity:135/394 - (34%)
Similarity:216/394 - (54%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLRCLRQQPAKPAAVMTHKEDQYPVSLDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRI 69
            ::.|...:.||       :..:....:|..:.:|.....|:  :|:|||||.||||:|.||||||
Zfish     6 MMACCLSEEAK-------ESKRINAEIDKQLRRDKRDARRE--LKLLLLGTGESGKSTFIKQMRI 61

  Fly    70 LHINGFTDDERREKIPEIYQNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPEYMNE 134
            :|..|:||:::|.....:||||..|:..::.....|.|.:....::.:|..:..:........:.
Zfish    62 IHGAGYTDEDKRGFTKLVYQNIFTSMQAMIRATETLKIGYKYEQNKANAMLVKEVDIEKVMSFDH 126

  Fly   135 EYCDHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQ 199
            .|.:.|..||:|.||:..|||..|:.|.||.||:|.:..||:::.|:|:.:|:|..|..||||.:
Zfish   127 PYINAVKMLWSDPGIQEAYDRRREYQLSDSTKYYLSDLDRIAESSYLPTQQDVLRVRIPTTGIIE 191

  Fly   200 ITFRVPIPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRL 264
            ..|.:   :|:     .|:|.||||||.:|.|||..||.:.:::||::.||:||.|.|..::||:
Zfish   192 YPFDL---QSI-----IFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRM 248

  Fly   265 QEALKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESD 329
            :|:..|||.:....:..::.:|:||||.|::|.|| :..|:||||||::.    ||:|     :.
Zfish   249 EESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI-SYSHLVDYFPEFDG----PQRD-----AQ 303

  Fly   330 WTKMFIKQKLVDITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVS 394
            ..:.||.:..||:..:              |::..|.|||.||||..||.||..|:..||..|:.
Zfish   304 AAREFILKMFVDLNPD--------------SDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK 354

  Fly   395 SMGL 398
            ...|
Zfish   355 EYNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 131/366 (36%)
G-alpha 48..392 CDD:206639 127/343 (37%)
gna11bNP_001007774.1 G_alpha 19..357 CDD:214595 131/371 (35%)
G-alpha 40..353 CDD:206639 127/344 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.