DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gna15.1

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001003626.2 Gene:gna15.1 / 445232 ZFINID:ZDB-GENE-040801-146 Length:367 Species:Danio rerio


Alignment Length:395 Identity:140/395 - (35%)
Similarity:213/395 - (53%) Gaps:46/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLRQQPAKPAAVMTHKEDQYPVSLDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHI 72
            ||.::...  |::.|.|.:       .:|.:..|..| ..:|:|||||.||||||.||||||:|.
Zfish    14 CLSEEDKN--AIVIHNEIK-------RILAEQKKRER-REIKVLLLGTGESGKTTFIKQMRIIHG 68

  Fly    73 NGFTDDERREKIPEIYQNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPEYMNEEYC 137
            .||::::||..|..:||||..::..:.|.|..|.|.:.:..:|........:.......::..|.
Zfish    69 KGFSEEDRRGYIKNVYQNIFTAMRAMTGAMESLRIPYANPQNEAYGRQFKDVEIRQVTQLDRMYV 133

  Fly   138 DHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITF 202
            :.:..||.|.||:|||.|..|:.||||.:|::.|..||:..:|||:.:|:|..|..||||:..:|
Zfish   134 EAIRRLWADPGIKACYCRRREYQLLDSTEYYMTNLDRIAAPDYIPTAQDVLRVRFPTTGINDYSF 198

  Fly   203 RVPIPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEA 267
            .|.        :...::.|||||:.:|.|||..||.:.:::||.|.||:||.|.|:..:||::|:
Zfish   199 SVE--------KITLRIVDVGGQKSERRKWIHCFENVTSLIFLASLSEYDQVLEENSKENRMKES 255

  Fly   268 LKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTK 332
            |.||.....:.:.|||.:|:||||.||:|.||:: ..:..||||::. .:|..||        .|
Zfish   256 LSLFYTTIHSPWFASASIILFLNKMDILEEKIQS-SDLKAYFPEFQG-RRRDVQD--------AK 310

  Fly   333 MFIKQKLVDITQEPFKRHSRNQ----VDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENV 393
            .:|.             |...|    .:..|| ::.|.|||.||||..||.||.||:..:|..::
Zfish   311 SYIS-------------HLYEQKAKCTETKTS-KQIYPHFTCATDTNNIRKVFGDVKDTVLIRSL 361

  Fly   394 SSMGL 398
            ...|:
Zfish   362 REYGV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 134/370 (36%)
G-alpha 48..392 CDD:206639 131/347 (38%)
gna15.1NP_001003626.2 G-alpha 44..361 CDD:206639 131/348 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.