DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and dnd

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster


Alignment Length:108 Identity:30/108 - (27%)
Similarity:49/108 - (45%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LHSRKITTGISQITFRVPIPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFD 252
            |.|..|||......|.:   ||:.....:..::|:|||...|..|...|.....::::|.|::  
  Fly    37 LASEDITTVTPTAGFNI---KSVAADGFKLNVWDIGGQWKIRPYWKNYFANTDVLIYVIDCTD-- 96

  Fly   253 QNLREDPSQNRLQEA-LKLFRAVWQNRFLASAGLIVFLNKYDI 294
                    :.||.|| .:||..:..|| |....:::|.||.|:
  Fly    97 --------RTRLPEAGSELFEMLMDNR-LKQVPVLIFANKQDM 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 30/108 (28%)
G-alpha 48..392 CDD:206639 30/108 (28%)
dndNP_650995.1 Arl3 3..176 CDD:206721 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.