DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnas

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_031750701.1 Gene:gnas / 407931 XenbaseID:XB-GENE-947774 Length:412 Species:Xenopus tropicalis


Alignment Length:356 Identity:139/356 - (39%)
Similarity:209/356 - (58%) Gaps:35/356 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHESILQLVGQMGVLG--IDFGS 111
            ::||||..||||:||:|||||||:|||..:|::.|:.:|..||.|:|..:|..|..|.  ::..:
 Frog    75 RLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKIKVQDIKNNIKEAIETIVTAMCNLSPPVELAN 139

  Fly   112 CTSERSADYILSLPGSAPEYMNEEYCDHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRIS 176
            ..::...||||:||.......:.|:.:|..|||.|.|:|.||:||||:.|:|.|:||||....:.
 Frog   140 PENQFRIDYILNLPSHKDFDFSPEFYEHTKTLWQDEGVRLCYERSNEYQLIDCAQYFLDKIDIVK 204

  Fly   177 DAEYIPSTEDILHSRKITTGISQITFRVPIPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQA 241
            ..:|.|:.:|:|..|.:|:||.:..|:|        .:..|.|:|||||||:|.||||.|..:.|
 Frog   205 QNDYTPTDQDLLRCRVLTSGIFETKFQV--------DKVNFHMFDVGGQRDERRKWIQCFNDVTA 261

  Fly   242 VLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGK-HI 305
            ::|:::.|.::..:|||...|||||||.||:::|.||:|.:..:|:||||.|::..|::.|| .|
 Frog   262 IIFVVASSSYNMVIREDNHTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVKVGKSKI 326

  Fly   306 VDYFPEY------EDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPFKRHSRNQVDLGTSEREC 364
            .|||||:      :|....|.::   .:....|.||:.:.:.|:...           |.....|
 Frog   327 EDYFPEFARYTTPDDATPEPGEE---PQVTRAKYFIRDEFLRISTAS-----------GDGRHYC 377

  Fly   365 YYHFTVATDTRCIRDVFCD----VQKMILSE 391
            |.|||.|.||..||.||.|    :|:|.|.:
 Frog   378 YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQ 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 139/356 (39%)
G-alpha 48..392 CDD:206639 139/356 (39%)
gnasXP_031750701.1 G-alpha 74..406 CDD:206639 138/352 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325067at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.