DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnai2

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_989250.1 Gene:gnai2 / 394861 XenbaseID:XB-GENE-6050844 Length:355 Species:Xenopus tropicalis


Alignment Length:375 Identity:133/375 - (35%)
Similarity:212/375 - (56%) Gaps:42/375 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SLDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHES 94
            ::|.::.:|..|..|:  ||:||||..||||:||:|||:|:|.:|::::|.|:....::.|..:|
 Frog    18 NIDKNLREDGEKAARE--VKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVFSNTIQS 80

  Fly    95 ILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPE--YMNEEYCDHVTTLWNDVGIRACYDRSN 157
            |:.::..||.|.||||.......|..:.:|..:|.|  .:.::....:..||.|.|::||:.||.
 Frog    81 IMAIIKAMGNLKIDFGDPARADDARQLFALSSTAEEQGILPDDLAGVIRRLWADPGVQACFSRSR 145

  Fly   158 EFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGI--SQITFRVPIPKSMGGGEQQFQMY 220
            |:.|.|||.|:|::..||:.::|:|:.:|:|.:|..||||  :..||:          :..|:|:
 Frog   146 EYQLNDSAAYYLNDLERIARSDYVPTQQDVLRTRVKTTGIVETHFTFK----------DLHFKMF 200

  Fly   221 DVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLASAGL 285
            ||||||.:|.|||..|||:.|::|.::.|.:|..|.||...||:.|::|||.::..|::.....:
 Frog   201 DVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSI 265

  Fly   286 IVFLNKYDIMERKI-RAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPFKR 349
            |:||||.|:.|.|| |:...|.  ||||..          ..:.|....:|:.|..|:.    ||
 Frog   266 ILFLNKKDLFEEKITRSPLSIC--FPEYSG----------ANQYDEAASYIQTKFEDLN----KR 314

  Fly   350 HSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGLF 399
            .         ..:|.|.|||.||||:.::.||..|..:|:..|:...|||
 Frog   315 R---------DTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 130/371 (35%)
G-alpha 48..392 CDD:206639 125/348 (36%)
gnai2NP_989250.1 G-alpha 34..349 CDD:206639 125/349 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.