DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnai1

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_957265.1 Gene:gnai1 / 393946 ZFINID:ZDB-GENE-040426-1310 Length:354 Species:Danio rerio


Alignment Length:383 Identity:140/383 - (36%)
Similarity:213/383 - (55%) Gaps:43/383 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDQYPVS----LDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKI 84
            ||:..|.    :|.::..|..|..|:  ||:||||..||||:||:|||:|:|..|::::|.::..
Zfish     8 EDKAAVERSKMIDRNLRDDGEKAARE--VKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYK 70

  Fly    85 PEIYQNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPE-YMNEEYCDHVTTLWNDVG 148
            ..:|.|..:||:.::..||.|.||||.......|..:..|.|||.| :|..|....:..||.|.|
Zfish    71 AVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGSAEEGFMTAELAGVIKRLWKDGG 135

  Fly   149 IRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGI--SQITFRVPIPKSMG 211
            ::||:.||.|:.|.|||.|:|::..|||.|.|||:.:|:|.:|..||||  :..||:        
Zfish   136 VQACFSRSREYQLNDSAAYYLNDLDRISQATYIPTQQDVLRTRVKTTGIVETHFTFK-------- 192

  Fly   212 GGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQ 276
              :..|:|:||||||.:|.|||..|||:.|::|.::.|::|..|.||...||:.|::|||.::..
Zfish   193 --DLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICN 255

  Fly   277 NRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVD 341
            |::.....:|:||||.|:.|.|||.....:.| |||..       .|.:.|:   ..:|:.:..|
Zfish   256 NKWFTDTSIILFLNKKDLFEEKIRKSTLTICY-PEYAG-------SNTYEEA---AAYIQCQFED 309

  Fly   342 ITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGLF 399
            :.:.             ...:|.|.|||.||||:.::.||..|..:|:..|:...|||
Zfish   310 LNKR-------------KDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 134/373 (36%)
G-alpha 48..392 CDD:206639 129/346 (37%)
gnai1NP_957265.1 G_alpha 14..352 CDD:214595 134/373 (36%)
G-alpha 34..348 CDD:206639 129/347 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586297
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.