DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and Gnat2

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001102420.2 Gene:Gnat2 / 365901 RGDID:1309514 Length:354 Species:Rattus norvegicus


Alignment Length:377 Identity:137/377 - (36%)
Similarity:212/377 - (56%) Gaps:46/377 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KDMAKGVRD-------------TTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIY 88
            |::||..|:             .|||:||||..||||:||:|||:|:|.:|::.:|..|....||
  Rat    10 KELAKRSRELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKSVIY 74

  Fly    89 QNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPE-YMNEEYCDHVTTLWNDVGIRAC 152
            .|:.:|||.::..|..||||:...:...:...:.:|..|..| .|..|..:.:..||.|.|::||
  Rat    75 GNVLQSILAIIRAMSTLGIDYAEPSCAEAGRQLNNLADSTEEGTMPSELVEVIRKLWKDGGVQAC 139

  Fly   153 YDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITFRVPIPKSMGGGEQQF 217
            :||:.||.|.|||.|:|:...||:|.:|:|:.:|:|.||..||||.:..|.|.        :..|
  Rat   140 FDRAAEFQLNDSASYYLNQLDRITDPDYLPNEQDVLRSRVKTTGIIETKFSVK--------DLNF 196

  Fly   218 QMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLAS 282
            :|:||||||.:|.|||..|||:..::|..:.|.:|..|.||...||:.|:|.||.::..::|.|:
  Rat   197 RMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAA 261

  Fly   283 AGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPF 347
            ..:::||||.|:.|.||:. .|:...||||:.       :|.:.::.   .:||.:.:|:     
  Rat   262 TSIVLFLNKKDLFEEKIKK-VHLSICFPEYDG-------NNSYEDAG---NYIKSQFLDL----- 310

  Fly   348 KRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGLF 399
              :.|..|      :|.|.|.|.||||:.::.||..|..:|:.||:...|||
  Rat   311 --NMRKDV------KEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 134/373 (36%)
G-alpha 48..392 CDD:206639 127/344 (37%)
Gnat2NP_001102420.2 G-alpha 34..348 CDD:206639 128/345 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345190
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.