DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and CG17760

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster


Alignment Length:392 Identity:133/392 - (33%)
Similarity:204/392 - (52%) Gaps:44/392 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLRQQPAKPAAVMTHKEDQYPVSLDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHI 72
            ||..|..        :|.:....:|..:..:..|..|:  :|:|:|||.||||||.||||||:|.
  Fly     4 CLSDQAC--------EERRISREIDKFLKAEKKKARRE--LKLLVLGTGESGKTTFIKQMRIIHG 58

  Fly    73 NGFTDDERREKIPEIYQNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPEYMNEEYC 137
            .||.|.||::....::|||..:|..::..|..|.|.:|.....:.||.:.|:.......:...|.
  Fly    59 KGFLDKERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAPYL 123

  Fly   138 DHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITF 202
            :.:.|||.|.||:.||:|..|:.|.||.:|||::..||..::|..:.:||||.|..||.|     
  Fly   124 NAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNI----- 183

  Fly   203 RVPIPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEA 267
             |..|.::.|  ...::.||.|||.:|.|||..|..:.:::||::.||||.:|.|..:.||::|:
  Fly   184 -VEYPFNLDG--FLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKES 245

  Fly   268 LKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTK 332
            ..||..:....:...:.:|:||||.|:.::|| ...|:.||||||..    |::|     :...:
  Fly   246 KALFHNIISFSWFQHSSVILFLNKEDLFKKKI-LSTHLADYFPEYNG----PKKD-----AKAAR 300

  Fly   333 MFIKQKLVDITQEPFKRHSRNQVDLGTSERECYY-HFTVATDTRCIRDVFCDVQKMILSENVSSM 396
            .||......:..:|:|               |.| ||||||:|..|:.||..|:..||..::|..
  Fly   301 EFILYMFTSVNPDPYK---------------CIYPHFTVATNTENIKFVFTAVKDTILELHLSET 350

  Fly   397 GL 398
            .|
  Fly   351 NL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 128/367 (35%)
G-alpha 48..392 CDD:206639 124/344 (36%)
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 128/372 (34%)
G-alpha 34..347 CDD:206639 124/345 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D63213at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.