DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gna13b

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001013281.2 Gene:gna13b / 336333 ZFINID:ZDB-GENE-030131-8277 Length:377 Species:Danio rerio


Alignment Length:377 Identity:136/377 - (36%)
Similarity:205/377 - (54%) Gaps:43/377 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHESI 95
            :|..:.|:  |......|||||||..||||:|.:|||||:|.:.|...::.|....||.|:.:.:
Zfish    34 IDREIFKE--KTFVKRLVKILLLGAGESGKSTFLKQMRIIHGDDFDKGDKEEFRGTIYSNVMKGV 96

  Fly    96 LQLVGQMGVLGIDFGSCTSERSADYILSL--------PGSAPEYMNEEYCDHVTTLWNDVGIRAC 152
            ..||.....|.|.:|:.:::..||.:::.        .|.....:..:|...:..||.|:||:..
Zfish    97 RVLVDAREKLHIPWGNPSNQTHADIMMAFDTRSTMVSQGMLETKLFPQYLPSIRALWADIGIQHA 161

  Fly   153 YDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITFRVP-IPKSMGGGEQQ 216
            |||..||.|.:|.||||||..::...:|:|:.:|||.:||.|.||.:..|.:. :|         
Zfish   162 YDRRREFQLGESVKYFLDNLDKLGAPDYLPTQQDILLARKPTKGIHEYDFEIKNVP--------- 217

  Fly   217 FQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLA 281
            |:|.||||||.:|.:|.:.||.:.::|||:|.||:||.|.||...|||.|:|.:|..:..||...
Zfish   218 FKMVDVGGQRSERRRWFECFESVTSILFLVSSSEYDQVLMEDRQTNRLMESLNIFETIVNNRVFN 282

  Fly   282 SAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEP 346
            :..:|:||||.|::|.|::: ..|.|||||:.|      ...|.|:       :|..||    |.
Zfish   283 NVSIILFLNKTDLLEEKVKS-VSIQDYFPEFTD------DPWCLGD-------VKNFLV----EC 329

  Fly   347 FKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGL 398
            |:...|:|     .::..|:|||.|.:|..||.||.||:..||.:|:..:.|
Zfish   330 FRNKRRDQ-----QQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLML 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 135/374 (36%)
G-alpha 48..392 CDD:206639 131/352 (37%)
gna13bNP_001013281.2 G_alpha 29..375 CDD:214595 135/374 (36%)
G-alpha 49..371 CDD:206639 131/353 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.