DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnai2b

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_956136.1 Gene:gnai2b / 327650 ZFINID:ZDB-GENE-030131-5861 Length:347 Species:Danio rerio


Alignment Length:367 Identity:128/367 - (34%)
Similarity:205/367 - (55%) Gaps:40/367 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHESILQLVGQ 101
            |.:.|.:|:  ||:||||..||||:||:|||:|:|.:|:::||.::....:|.|..:||:.::..
Zfish    17 KMIDKNLRE--VKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKA 79

  Fly   102 MGVLGIDFGSCTSERSADYILSLPGSAPE--YMNEEYCDHVTTLWNDVGIRACYDRSNEFPLLDS 164
            |..|.||:|.......|..:.:|..:|.|  .:.::..:.:..||.|.|::.|:.||.|:.|.||
Zfish    80 MSNLKIDYGESARVDDARQLFALSAAAEEQGILTDDLANVIRRLWADSGVQGCFSRSREYQLNDS 144

  Fly   165 AKYFLDNFVRISDAEYIPSTEDILHSRKITTGI--SQITFRVPIPKSMGGGEQQFQMYDVGGQRD 227
            |.|:|::..||:.::|||:.:|:|.:|..||||  :..||:          :..|:|:||||||.
Zfish   145 AAYYLNDLDRIARSDYIPTQQDVLRTRVKTTGIVETHFTFK----------DLHFKMFDVGGQRS 199

  Fly   228 QRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLASAGLIVFLNKY 292
            :|.|||..|||:.|::|.::.|.:|..|.||...||:.|::|||.::..|::.....:|:||||.
Zfish   200 ERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKK 264

  Fly   293 DIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPFKRHSRNQVDL 357
            |:.|.||.... :...||||....|          .|....:|:.|..|:.::            
Zfish   265 DLFEEKITRSP-LTICFPEYSGANK----------YDEAASYIQTKFEDLNKK------------ 306

  Fly   358 GTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGLF 399
             ...:|.|.|||.||||:.::.||..|..:|:..|:...|||
Zfish   307 -KDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 125/363 (34%)
G-alpha 48..392 CDD:206639 121/347 (35%)
gnai2bNP_956136.1 G_alpha 13..345 CDD:214595 125/363 (34%)
G-alpha 26..341 CDD:206639 121/348 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.