DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gpa-9

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001256444.1 Gene:gpa-9 / 191659 WormBaseID:WBGene00001671 Length:96 Species:Caenorhabditis elegans


Alignment Length:120 Identity:33/120 - (27%)
Similarity:59/120 - (49%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 FLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDIT 343
            :..|..:|:||||.|:.|.|| ...:|...||:||.    |::.:|..|      :|:.:.:.: 
 Worm     2 YFHSTAIILFLNKIDLFEIKI-THTNITVAFPDYEG----PRERDCALE------YIRVQFISL- 54

  Fly   344 QEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGL 398
                 .:::|        |:.|.|.|.||||..|:.|...:..:|:|.::..:|:
 Worm    55 -----NNNKN--------RKIYQHVTSATDTARIQVVIDMLFDIIISASLKMVGV 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 32/117 (27%)
G-alpha 48..392 CDD:206639 32/112 (29%)
gpa-9NP_001256444.1 P-loop_NTPase <2..91 CDD:304359 32/113 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.