DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gpa-18

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001293719.1 Gene:gpa-18 / 189161 WormBaseID:WBGene00020997 Length:320 Species:Caenorhabditis elegans


Alignment Length:360 Identity:73/360 - (20%)
Similarity:130/360 - (36%) Gaps:81/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQ----NIHESILQLVGQMGVLGID 108
            ::.|:||...:|||:.|:||...|.....  .|||......|    ||:..:..::   ..|.|.
 Worm    12 IRTLVLGCMGAGKTSFIRQMVKNHTKSIC--LRRELYLYCVQLNLLNIYRELKNVI---EALEIP 71

  Fly   109 FGSCTSERSADYILSLPGSAPEYMNEE-----YCDHVTTLWNDVGIRACYDRSNEFPLLDSAKYF 168
            ......:|..        ...||.:.|     ..:.:..|:.......|..|....||..:..:.
 Worm    72 ISEDQKQRFT--------QLDEYRHREVFPPKIIEAMKELFESGLYELCRLRQRILPLPQNYHFL 128

  Fly   169 L---DNFVRISDAEYIPSTEDILHSRKITTGISQITFRVPIPKSMGGGEQQFQMYDVGGQRDQRN 230
            .   |:|:   :.||:||..:|:.|...|.|:::        :::.....:|::.::.|....|.
 Worm   129 FQRGDDFM---NPEYVPSELEIMMSYSQTCGLNR--------ENVTCQGYKFELLEMPGHHLWRA 182

  Fly   231 KWIQVFEGIQAVLFLISCSEFDQNLREDPS-------QNRLQEALKLFRAVWQNRFLASAGLIVF 288
            ||...|:....|:|:|..||..     ||:       :|:   .:.:|.::..|..||....::.
 Worm   183 KWADYFDDPNLVVFVIDLSELC-----DPAFYNKGYLENK---TVTVFESLVNNPVLAKVYWLLL 239

  Fly   289 LNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPFKRHSRN 353
            .||.|..      ..|...:     ||.|..   |....:|..:.|.                |:
 Worm   240 FNKADTF------NDHSAGF-----DFRKLA---NHLDTADSARSFY----------------RS 274

  Fly   354 QVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMI 388
            |.....|:..|:.|.....:.:..:.|..::.|.|
 Worm   275 QFTTKISKTRCFPHIVSLVNFKESQSVMMEMFKKI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 73/360 (20%)
G-alpha 48..392 CDD:206639 73/360 (20%)
gpa-18NP_001293719.1 G-alpha 12..309 CDD:278904 72/358 (20%)
P-loop_NTPase 12..289 CDD:304359 69/338 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.