DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gpa-14

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001020966.2 Gene:gpa-14 / 172269 WormBaseID:WBGene00001676 Length:408 Species:Caenorhabditis elegans


Alignment Length:406 Identity:119/406 - (29%)
Similarity:181/406 - (44%) Gaps:82/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HKEDQYPVSLDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGF-TDDERREKIP 85
            |.|.:..::|:        |....:.:|||:||...|||:||.|||:|:|::|| ||.|..:...
 Worm    55 HMEIEKELALE--------KKTYGSHIKILILGGPLSGKSTIFKQMQIIHVDGFKTDQELIQYRG 111

  Fly    86 EIYQNIHESILQLVGQMGVLGIDFG---SCTSERSADYILSLPGSAPEYMNE--------EYCDH 139
            .|..||.:..|||:....|:||...   ..|.|....|       ||  |::        |..:.
 Worm   112 LIDNNIRDIYLQLIAGSRVVGIPLDPIEHITYEIDEIY-------AP--MSDAFSVRTISELLEP 167

  Fly   140 VTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITFRV 204
            :|..||...|:..|.|..||.||||.||:|:|..||:|..|:|:.|||:||||.|..|:.|.|..
 Worm   168 LTEFWNSKQIQEIYKRRCEFELLDSTKYYLENLTRIADPTYLPNQEDIVHSRKATMSINSIVFEY 232

  Fly   205 PIPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALK 269
            .        .....|.||||||.:|.||:.:|:..:.|||:|..:.:.:  |.:.|:..|....|
 Worm   233 T--------GVSLLMIDVGGQRSERKKWLHLFDDAKVVLFVIDLTGYAK--RSEESRMELSRFPK 287

  Fly   270 LFRAVWQNRF-----------------LASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCK 317
            .||.|..|.:                 ||:|..::|.||.|:                 :::...
 Worm   288 FFRDVGSNAYDMKVALKIFNEVAAASALANAVFLLFFNKVDL-----------------FKEILS 335

  Fly   318 RPQQDNCFGESDWTKMFIKQKLVDITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFC 382
            :.....||.:.|....:         :|..|......:...:|::..:.|||.||:|..::.||.
 Worm   336 QVNLQPCFSKFDGENTY---------EETSKYICEKFIRAASSKKSVFPHFTTATNTENVKLVFR 391

  Fly   383 DVQKMILSENVSSMGL 398
            ...:.:...|..:.||
 Worm   392 ACMESVFKANAKATGL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 115/395 (29%)
G-alpha 48..392 CDD:206639 112/372 (30%)
gpa-14NP_001020966.2 G_alpha 52..406 CDD:214595 117/403 (29%)
G-alpha 73..401 CDD:206639 112/372 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.