DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and Gnaq

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_032165.3 Gene:Gnaq / 14682 MGIID:95776 Length:359 Species:Mus musculus


Alignment Length:396 Identity:136/396 - (34%)
Similarity:214/396 - (54%) Gaps:45/396 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLRCLRQQPAKPAAVMTHKEDQYPVSLDHHVLKDMAKGVRDT--TVKILLLGTAESGKTTIIKQM 67
            ::.|...:.||.|.           .::..:.:.:.:..||.  .:|:|||||.||||:|.||||
Mouse     6 IMACCLSEEAKEAR-----------RINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQM 59

  Fly    68 RILHINGFTDDERREKIPEIYQNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPEYM 132
            ||:|.:|::|:::|.....:||||..::..::..|..|.|.:....::..|..:..:........
Mouse    60 RIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAF 124

  Fly   133 NEEYCDHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGI 197
            ...|.|.:.:||||.||:.||||..|:.|.||.||:|::..|::|..|:|:.:|:|..|..||||
Mouse   125 ENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGI 189

  Fly   198 SQITFRVPIPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQN 262
            .:..|.:.        ...|:|.||||||.:|.|||..||.:.:::||::.||:||.|.|..::|
Mouse   190 IEYPFDLQ--------SVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNEN 246

  Fly   263 RLQEALKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGE 327
            |::|:..|||.:....:..::.:|:||||.|::|.||.. .|:|||||||:.    ||:|     
Mouse   247 RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMY-SHLVDYFPEYDG----PQRD----- 301

  Fly   328 SDWTKMFIKQKLVDITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSEN 392
            :...:.||.:..||:..:              |::..|.|||.||||..||.||..|:..||..|
Mouse   302 AQAAREFILKMFVDLNPD--------------SDKIIYSHFTCATDTENIRFVFAAVKDTILQLN 352

  Fly   393 VSSMGL 398
            :....|
Mouse   353 LKEYNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 131/368 (36%)
G-alpha 48..392 CDD:206639 128/343 (37%)
GnaqNP_032165.3 G-alpha 40..353 CDD:206639 128/344 (37%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 41..54 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 178..186 3/7 (43%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 201..210 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 270..277 5/6 (83%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 329..334 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.