DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and LOC108179047

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_021326059.1 Gene:LOC108179047 / 108179047 -ID:- Length:160 Species:Danio rerio


Alignment Length:168 Identity:60/168 - (35%)
Similarity:86/168 - (51%) Gaps:45/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 LREDPSQNRLQEALKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGK-HIVDYFPEYEDF--- 315
            :|||.:.|||:|||.|||::|.||:|.:..:|:||||.|::..|:.||| .|.||||::..:   
Zfish     3 IREDNNTNRLREALALFRSIWNNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPDFAYYTLP 67

  Fly   316 -------C--KRPQQDNCFGE--SDWT------------KMFIKQKLVDITQEPFKRHSRNQVDL 357
                   |  ||.:::   ||  |:.|            |.||:.:.:.|:.|.           
Zfish    68 DKVKKRKCVWKRKKRN---GEDVSNITPDPGEDPRVTRAKFFIRDEFLKISTES----------- 118

  Fly   358 GTSERECYYHFTVATDTRCIRDVFCD----VQKMILSE 391
            |.....||.|||.|.||..||.||.|    :|:|.|.:
Zfish   119 GDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQ 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 60/168 (36%)
G-alpha 48..392 CDD:206639 60/168 (36%)
LOC108179047XP_021326059.1 P-loop_NTPase <1..154 CDD:328724 59/164 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325067at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.