DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and GNA13

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_006563.2 Gene:GNA13 / 10672 HGNCID:4381 Length:377 Species:Homo sapiens


Alignment Length:360 Identity:136/360 - (37%)
Similarity:200/360 - (55%) Gaps:41/360 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHESILQLVGQMGVLGIDFGSC 112
            |||||||..||||:|.:|||||:|...|....|.|..|.||.|:.:.:..||.....|.|.:|..
Human    49 VKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDN 113

  Fly   113 TSERSADYILSLPGSAP---EYMNE-----EYCDHVTTLWNDVGIRACYDRSNEFPLLDSAKYFL 169
            ::::..|.::|....||   :.|.|     :|...:..||.|.||:..|||..||.|.:|.||||
Human   114 SNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFL 178

  Fly   170 DNFVRISDAEYIPSTEDILHSRKITTGISQITFRVP-IPKSMGGGEQQFQMYDVGGQRDQRNKWI 233
            ||..::.:.:||||.:|||.:|:.|.||.:..|.:. :|         |:|.||||||.:|.:|.
Human   179 DNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVP---------FKMVDVGGQRSERKRWF 234

  Fly   234 QVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLASAGLIVFLNKYDIMERK 298
            :.|:.:.::|||:|.|||||.|.||...|||.|:|.:|..:..||..::..:|:||||.|::|.|
Human   235 ECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEK 299

  Fly   299 IRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPFKRHSRNQVDLGTSERE 363
            ::. ..|.|||.|:|.      ..:|..:       :::.||    |.|:...|:|     .::.
Human   300 VQI-VSIKDYFLEFEG------DPHCLRD-------VQKFLV----ECFRNKRRDQ-----QQKP 341

  Fly   364 CYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGL 398
            .|:|||.|.:|..||.||.||:..||.:|:..:.|
Human   342 LYHHFTTAINTENIRLVFRDVKDTILHDNLKQLML 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 135/357 (38%)
G-alpha 48..392 CDD:206639 134/352 (38%)
GNA13NP_006563.2 G_alpha 29..375 CDD:214595 135/357 (38%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 50..63 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 195..203 4/7 (57%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 218..227 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 287..294 5/6 (83%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 347..352 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.