DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and fdx1

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_002938002.1 Gene:fdx1 / 100379765 XenbaseID:XB-GENE-990886 Length:167 Species:Xenopus tropicalis


Alignment Length:179 Identity:39/179 - (21%)
Similarity:67/179 - (37%) Gaps:65/179 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LLGTAESG----KTTIIKQMRIL---HINGFTDDER-------REKIPEIYQ-NIHESILQLVGQ 101
            |||::..|    :|.:..:...|   ||..|:.:::       |:....:.| .:.||:|.:|.:
 Frog    14 LLGSSRLGVPAVRTVMCPRSSRLGPGHIRAFSSEDKVTVKFINRDGETLVAQGKVGESLLDVVVE 78

  Fly   102 MGVLGID-FGSC--TSERSADYILSLPGSAPEYMNEEYCDHVTTLWNDVGIRACYDRSNEFPLLD 163
            .. |.|| ||:|  |...|..:::             :.||:                  |..||
 Frog    79 KN-LDIDGFGACEGTLACSTCHLI-------------FEDHI------------------FQQLD 111

  Fly   164 SAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITFRVPIPKSMGG 212
            .          |:|.|.     |:|......|..|::..::.:.|||.|
 Frog   112 P----------ITDEEM-----DMLDLAYGLTDTSRLGCQICLKKSMNG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 39/179 (22%)
G-alpha 48..392 CDD:206639 39/179 (22%)
fdx1XP_002938002.1 fer2 50..162 CDD:381830 30/143 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.