DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gna13

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001120411.1 Gene:gna13 / 100145489 XenbaseID:XB-GENE-6257775 Length:377 Species:Xenopus tropicalis


Alignment Length:398 Identity:137/398 - (34%)
Similarity:201/398 - (50%) Gaps:52/398 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PAAVMTHKE-DQYPVSLDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDE 79
            |..|:|.:| :|...|.:........|......|||||||..||||:|.:|||||:|...|....
 Frog    16 PNCVLTSREAEQQRKSKEIDRCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDLRA 80

  Fly    80 RREKIPEIYQNIHESILQLVGQMGVLGIDFGSCTSERSADYILSL--------PGSAPEYMNEEY 136
            :.|....||.|:.:.|..||.....|.|.:|...:::..:.:::.        .|.....:...:
 Frog    81 KEEFRATIYSNVIKGIRVLVDAREKLHIPWGDPANQKHGEVMMAFDTRSAMVAQGMVETQVFVSH 145

  Fly   137 CDHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQIT 201
            ...:.:||.|.||:..|||..||.|.:|.||||||..::.|.:|:||.:|||.:|:.|.||.:..
 Frog   146 LLSIRSLWADTGIQTAYDRRREFQLGESVKYFLDNLDKLGDKDYLPSQQDILLARRPTKGIHEYD 210

  Fly   202 FRVP-IPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQ 265
            |.:. :|         |:|.||||||.:|.:|.:.|:.:.::|||:|.||:||.|.||...|||.
 Frog   211 FEIKNVP---------FKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEYDQVLMEDRQTNRLT 266

  Fly   266 EALKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYE--DFCKRPQQD---NCF 325
            |:|.:|..:..||..::..:|:||||.|::|.|:|. ..|.|||.::|  ..|....|.   |||
 Frog   267 ESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVRI-VSIKDYFADFEGDPHCLEDVQKFLVNCF 330

  Fly   326 GESDWTKMFIKQKLVDITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILS 390
                      :.|..|..|:|.                 |:|||.|.:|..||.||.||:..||.
 Frog   331 ----------RNKRRDQQQKPL-----------------YHHFTTAINTENIRLVFRDVKDTILH 368

  Fly   391 ENVSSMGL 398
            :|:..:.|
 Frog   369 DNLKQLML 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 131/380 (34%)
G-alpha 48..392 CDD:206639 128/357 (36%)
gna13NP_001120411.1 G_alpha 29..375 CDD:214595 131/382 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.