DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnat1

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001096278.1 Gene:gnat1 / 100124843 XenbaseID:XB-GENE-1003264 Length:350 Species:Xenopus tropicalis


Alignment Length:377 Identity:134/377 - (35%)
Similarity:213/377 - (56%) Gaps:35/377 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDQYPVSLDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIY 88
            |:::...|:..:.:|..|..|  |||:||||..||||:||:|||:|:|.:|::.:|..|.|..||
 Frog     8 EEKHSRELEKKLKEDAEKDAR--TVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFISIIY 70

  Fly    89 QNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPE-YMNEEYCDHVTTLWNDVGIRAC 152
            .|..:|:|.:|..|..|.|.:|....:..:..:|.|..:..| .|.:|..|.:..||.|.||:||
 Frog    71 GNTLQSMLAIVRAMNTLNIQYGDPARQDDSRKLLHLADTIDEGSMPKEMSDIIGRLWKDTGIQAC 135

  Fly   153 YDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITFRVPIPKSMGGGEQQF 217
            :||::|:.|.|||.|:|::..|:....|:|:.:|:|.||..||||.:..|        |..:..|
 Frog   136 FDRASEYQLNDSAGYYLNDLERLVTPGYVPTEQDVLRSRVKTTGIIETQF--------GFKDLNF 192

  Fly   218 QMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLAS 282
            :|:||||||.:|.|||..|||:..::|:.:.|.:|..|.||...||:.|:|.||.::..:|:.|:
 Frog   193 RMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFAT 257

  Fly   283 AGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPF 347
            ..:::||||.|:...||:.. |:...||:|:.       .|.:.::.   .:||.:.:::     
 Frog   258 TSIVLFLNKKDVFTEKIKKA-HLSICFPDYDG-------PNTYEDAG---SYIKTQFLEL----- 306

  Fly   348 KRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGLF 399
              :.|..|      :|.|.|.|.||||..::.||..|..:|:.||:...|||
 Frog   307 --NMRRDV------KEIYSHMTCATDTENVKFVFDAVTDIIIKENLKDCGLF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 130/367 (35%)
G-alpha 48..392 CDD:206639 123/344 (36%)
gnat1NP_001096278.1 G-alpha 30..344 CDD:206639 124/345 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.