DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnai1

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001090865.1 Gene:gnai1 / 100038283 XenbaseID:XB-GENE-942094 Length:354 Species:Xenopus tropicalis


Alignment Length:383 Identity:136/383 - (35%)
Similarity:215/383 - (56%) Gaps:43/383 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDQYPVS----LDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKI 84
            ||:..|.    :|.::.:|..|..|:  ||:||||..||||:||:|||:|:|..|::::|.::..
 Frog     8 EDKAAVERSKMIDRNLREDGEKAARE--VKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYK 70

  Fly    85 PEIYQNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPE-YMNEEYCDHVTTLWNDVG 148
            ..:|.|..:||:.::..||.|.||||..:....|..:..|.|:|.| :|..|....:..||.|.|
 Frog    71 AVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDGG 135

  Fly   149 IRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGI--SQITFRVPIPKSMG 211
            ::||::||.|:.|.|||.|:|::..||:...|||:.:|:|.:|..||||  :..||:        
 Frog   136 VQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFK-------- 192

  Fly   212 GGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQ 276
              :..|:|:||||||.:|.|||..|||:.|::|.::.|::|..|.||...||:.|::|||.::..
 Frog   193 --DLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICN 255

  Fly   277 NRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVD 341
            |::.....:|:||||.|:.|.||:.....:.| |||..       .|.:.|:   ..:|:.:..|
 Frog   256 NKWFTDTSIILFLNKKDLFEEKIKRSPLTICY-PEYPG-------SNTYEEA---AAYIQCQFED 309

  Fly   342 ITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGLF 399
            :.:.             ...:|.|.|||.||||:.::.||..|..:|:..|:...|||
 Frog   310 LNKR-------------KDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 130/373 (35%)
G-alpha 48..392 CDD:206639 125/346 (36%)
gnai1NP_001090865.1 G-alpha 34..348 CDD:206639 125/347 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.