DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and AT1G75000

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_177637.1 Gene:AT1G75000 / 843838 AraportID:AT1G75000 Length:281 Species:Arabidopsis thaliana


Alignment Length:233 Identity:52/233 - (22%)
Similarity:90/233 - (38%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TWVFYYCGIYMLVIFG-GQHF-------MQNRPRFQLRGPLIIWNTL-LAMFS-------IMGAA 84
            ||.|.:..:...:|.. ..|.       :.||.|....||:...::| :::.|       ::.||
plant    28 TWSFLFTAVSSYIIAAVTLHLLLLITLSLSNRRRGFSLGPIPALHSLTISIISAVIFVGILLSAA 92

  Fly    85 ---RTAPELIHVLRHYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQPLIFL 146
               |....|....|...|...:|.|..........||::.|.||:...|..|.|.|:|::.|.|.
plant    93 AEIRDTRWLWRRTRTTALQWFLCFPVGTRASGRVFFWSYAFYLSRFLHLFRTFFSVIRRRKLSFF 157

  Fly   147 HWYHHITVLIYSWFSYTEYTSSARWF-IVMNYCVHSVMYSY-----YALKAARFNPPRFISMIIT 205
            ...:..::|..| |.:.||:.|.:.. |::....::|:|.|     ..|:.|.|   .|:.    
plant   158 QLINQSSLLCIS-FLWLEYSQSFQVVAILLTTVSYAVVYGYRFWTEIGLRGACF---PFVG---- 214

  Fly   206 SLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINL 243
              ....:::||              .:.||:....|:|
plant   215 --NCQAILLGC--------------MTVCHVGVLCIHL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 52/233 (22%)
AT1G75000NP_177637.1 ELO 26..276 CDD:395916 52/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.