DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and ELOVL7

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001098028.1 Gene:ELOVL7 / 79993 HGNCID:26292 Length:281 Species:Homo sapiens


Alignment Length:280 Identity:76/280 - (27%)
Similarity:125/280 - (44%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFENDFIHQRTRKWMLENW---------TWVFYYCGIYMLVIFG---------GQHFMQNRPRFQ 63
            |..:..:|      :.:||         .|:.....:...::.|         |...|:||..|:
Human     5 DLTSRTVH------LYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFE 63

  Fly    64 LRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSV-C-------VPSYIEQDRVCGFWTW 120
            |:..:|.:|..:.:||:.....      .|:..:|:.:|. |       .|:.:...|.|    |
Human    64 LKKAMITYNFFIVLFSVYMCYE------FVMSGWGIGYSFRCDIVDYSRSPTALRMARTC----W 118

  Fly   121 LFVLSKLPELGDTIFIVLRKQ--PLIFLHWYHHITVLIYSWFSYTEYTSS--ARWFIVMNYCVHS 181
            |:..||..||.||||.||||:  .:.|||.:|| |::.::|:...::.:.  ..:..::|..||.
Human   119 LYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHH-TIMPWTWWFGVKFAAGGLGTFHALLNTAVHV 182

  Fly   182 VMYSYYALKAARFNPPRFI--SMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLS 244
            ||||||.|.|......:::  ...:|||||.|.:| .||::....|::     .|..........
Human   183 VMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVI-VAIHISQFFFME-----DCKYQFPVFACI 241

  Fly   245 IAMYSSYF-VLFARFFYKAY 263
            |..||..| :||..|:|:||
Human   242 IMSYSFMFLLLFLHFWYRAY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 74/267 (28%)
ELOVL7NP_001098028.1 ELO 30..269 CDD:307345 71/249 (29%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.