DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and Elovl7

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_083277.3 Gene:Elovl7 / 74559 MGIID:1921809 Length:281 Species:Mus musculus


Alignment Length:260 Identity:78/260 - (30%)
Similarity:123/260 - (47%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GIYMLVIFG-GQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSV-C- 104
            |:|:..:.. |...|:||..|:|:..:|.:|..:.:||:.....      .|:..:|..:|. | 
Mouse    42 GLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYE------FVMSGWGTGYSFRCD 100

  Fly   105 VPSYIEQDR------VCGFWTWLFVLSKLPELGDTIFIVLRKQ--PLIFLHWYHHITVLIYSWFS 161
            :..|.:..|      .|    ||:..||..||.||||.||||:  .:.|||.:|| |::.::|:.
Mouse   101 IVDYSQSPRAMRMVHTC----WLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHH-TIMPWTWWF 160

  Fly   162 YTEYTSS--ARWFIVMNYCVHSVMYSYYALKAARFNPPRFISMI-----ITSLQLAQMIIGCAIN 219
            ..::.:.  ..:...:|..||.||||||.|.|.   .|.:...:     :|||||.|.:: ..|:
Mouse   161 GVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAM---GPAYQKYLWWKKHLTSLQLVQFVL-VTIH 221

  Fly   220 VWANGFLKTHGTSSCHISQRNINLSIAM-YSSYF-VLFARFFYKAY---------LAPGGHKSRR 273
            :....|::     .|:. |..:.|.|.| |...| :||..|:|:||         |..|..||:|
Mouse   222 IGQIFFME-----DCNY-QYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKR 280

  Fly   274  273
            Mouse   281  280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 75/256 (29%)
Elovl7NP_083277.3 ELO 30..269 CDD:279492 73/247 (30%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.