DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and elovl6

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001017257.2 Gene:elovl6 / 550011 XenbaseID:XB-GENE-942876 Length:265 Species:Xenopus tropicalis


Alignment Length:258 Identity:128/258 - (49%)
Similarity:168/258 - (65%) Gaps:8/258 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FDFENDFIHQRTRKWMLENWTWVFYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWNTLLAMFSI 80
            ::||..|......:||.|||...|.:..:|...||||:|.|:.|.:|:||.|||:|:..||:|||
 Frog    11 YEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMKQREKFELRKPLILWSLSLAVFSI 75

  Fly    81 MGAARTAPELIHVLRHYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQPLIF 145
            .||.||...::::|...||..|||..|:. ...|..||.:.|||||.|||||||||:||||.|||
 Frog    76 FGAVRTGAYMLYILMTKGLKQSVCDQSFY-YGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIF 139

  Fly   146 LHWYHHITVLIYSWFSYTEYTSSARWFIVMNYCVHSVMYSYYALKAARFNPPRFISMIITSLQLA 210
            ||||||||||:|||:||.:..:...||:.|||.||:||||||||:||.|...|..:|:||..|:.
 Frog   140 LHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMLITLSQIT 204

  Fly   211 QMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSSYFVLFARFFYKAYLAPGGHKSRR 273
            ||||||.:|.....::: .|....|:  :||..|..||.||||||..||::||:.    |:|:
 Frog   205 QMIIGCVVNYLVFSWMQ-QGQCPSHV--QNIVWSSIMYLSYFVLFCHFFFEAYIT----KTRK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 123/240 (51%)
elovl6NP_001017257.2 ELO 25..262 CDD:366492 125/244 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 249 1.000 Domainoid score I2078
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11456
Inparanoid 1 1.050 255 1.000 Inparanoid score I3086
OMA 1 1.010 - - QHG54116
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000936
OrthoInspector 1 1.000 - - otm47780
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.