DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and elovl1

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 / 549398 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis


Alignment Length:272 Identity:71/272 - (26%)
Similarity:115/272 - (42%) Gaps:78/272 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSVCVPSYIEQDRVCG 116
            |...|.||..|.|:..::::|                           |..|.:.:||..:.:..
 Frog    50 GPRIMANRKPFDLKPLMVVYN---------------------------FSLVALSAYIVYEFLMS 87

  Fly   117 FW-------------------------TWLFVLSKLPELGDTIFIVLRKQ--PLIFLHWYHHITV 154
            .|                         .|||:.||..||.||:|.|:||:  .:.|||.:|| :|
 Frog    88 GWLTGYTWRCDPVDVSDTPMALRMVRVAWLFLFSKFIELLDTVFFVVRKKNSQITFLHIFHH-SV 151

  Fly   155 LIYSWFSYTEY--TSSARWFIVMNYCVHSVMYSYYALKAARFNPPRFISMI-----ITSLQLAQM 212
            |.:||:...::  .....:..::|..||.:||.||.|.||   .|||...:     :|::||.|.
 Frog   152 LPWSWWWGVKFGPGGMGSFHAMINSLVHVIMYFYYGLSAA---GPRFQKYLWWKKHMTAIQLIQF 213

  Fly   213 IIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSS-YFVLFARFFYKAYLAPGGHKSRRM-A 275
            :: .:|::....|:     |||..........|.:|.: :|:||:.|:|:||.     |.||: .
 Frog   214 VL-VSIHISQYYFM-----SSCDYQYPIFIHLIWIYGTVFFILFSNFWYQAYT-----KGRRLPK 267

  Fly   276 ASLAAQNVVKQS 287
            .|..|...:.|:
 Frog   268 GSTVANGALHQN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 65/253 (26%)
elovl1NP_001016644.1 ELO 27..267 CDD:395916 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.