DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and Elovl1

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001034265.1 Gene:Elovl1 / 54325 MGIID:1858959 Length:279 Species:Mus musculus


Alignment Length:292 Identity:77/292 - (26%)
Similarity:125/292 - (42%) Gaps:94/292 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TWVFYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWNTLLAMFSI--------MGAART------ 86
            |:|::...:       |...|.||..|||||.:|::|..|.:.|:        .|...|      
Mouse    37 TYVYFILSL-------GPRIMANRKPFQLRGFMIVYNFSLVILSLYIVYEFLMSGWLSTYTWRCD 94

  Fly    87 ------APELIHVLRHYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQ--PL 143
                  :||.:.::|                      ..|||:|||:.||.||:..:|||:  .:
Mouse    95 PIDFSNSPEALRMVR----------------------VAWLFMLSKVIELMDTVIFILRKKDGQV 137

  Fly   144 IFLHWYHHITVLIYSWFSYTEYTSSARWFI------------VMNYCVHSVMYSYYALKAAR--F 194
            .|||.:|| :||.:||:          |.|            ::|..||.|||.||.|.|..  .
Mouse   138 TFLHVFHH-SVLPWSWW----------WGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVA 191

  Fly   195 NPPRFISMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSS-YFVLFARF 258
            .|..:....:|::||.|.:: .::::....|:     .||:.....|...|.||.: :|:||:.|
Mouse   192 QPYLWWKKHMTAIQLIQFVL-VSLHISQYYFM-----PSCNYQYPIIIHLIWMYGTIFFILFSNF 250

  Fly   259 FYKAYLAPGGHKSRRMAASLAAQNVVKQSSSP 290
            :|.:|.     |.:|:      ...|:|:.:|
Mouse   251 WYHSYT-----KGKRL------PRAVQQNGAP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 72/271 (27%)
Elovl1NP_001034265.1 ELO 23..260 CDD:366492 73/273 (27%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.