DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and elovl1a

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001005989.1 Gene:elovl1a / 449816 ZFINID:ZDB-GENE-041010-66 Length:315 Species:Danio rerio


Alignment Length:269 Identity:76/269 - (28%)
Similarity:118/269 - (43%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWNTLLAMFS--------IMGAARTAPELIHVLR 95
            |...|....|::.|..:|.:|..|:|...:|.:|..:..|:        :.|.|.|         
Zfish    38 FILLGYVFSVLYVGPRYMASRKPFRLNTAMIAYNFFMVAFNAYTVYEFLMSGWATT--------- 93

  Fly    96 HYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQ--PLIFLHWYHHITVLIYS 158
             |.....:|.||...|........|||..||..||.||:|.||||:  .:.|||.:|| :||.::
Zfish    94 -YTWRCDLCDPSSSPQALRMVRAAWLFYFSKYIELLDTVFFVLRKKHSQVTFLHIFHH-SVLPWT 156

  Fly   159 WF---SYTEYTSSARWFIVMNYCVHSVMYSYYALKAARFNPPRFISMI-----ITSLQLAQMIIG 215
            |:   :.|.......:..::|.|||.:||:||.|.||   .|||...:     :|::||.|.:: 
Zfish   157 WWWGITLTPAGGMGSFHALVNACVHVIMYTYYGLAAA---GPRFQKYLWWKKYMTAIQLIQFVL- 217

  Fly   216 CAINVWANGFLKTHGTSSCHISQRN------------INLSIAMYSSYFVLFARFFYKAYLAPGG 268
                  ..|          ||||..            |:|.:...:.:|:||:.|:.:||:    
Zfish   218 ------VTG----------HISQYYFMEKCDYQVPIFIHLILIYGTFFFILFSNFWIQAYI---- 262

  Fly   269 HKSRRMAAS 277
             |.:|:..|
Zfish   263 -KGKRLPVS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 73/261 (28%)
elovl1aNP_001005989.1 ELO 28..266 CDD:279492 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.