DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and CG6660

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_651104.1 Gene:CG6660 / 42708 FlyBaseID:FBgn0039030 Length:272 Species:Drosophila melanogaster


Alignment Length:287 Identity:73/287 - (25%)
Similarity:112/287 - (39%) Gaps:89/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MLENWTWVFYYCGIYM-LVIFGGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVL 94
            :|.|...|.....:|: .|:..|..:|.||..|:|:..:.::|.:..:         |...|.|:
  Fly    26 LLGNLWIVLAIVALYVAFVLHYGPRWMANRAPFELKRVMQVYNVVQVL---------ANATIFVI 81

  Fly    95 RHYGLFHSVCVPSYIEQDRVCGFWT--------------------WLFVLSKLPELGDTIFIVLR 139
               ||.::...|.|        .||                    :.:.:.|..:|.||:|||||
  Fly    82 ---GLSNTYLQPGY--------SWTCQPVDHTDRSPAMMKTLYASYAYYMLKYLDLLDTVFIVLR 135

  Fly   140 KQ--PLIFLHWYHH----ITVLIYSWFSYTEYTSSARWFIVMNYCVHSVMYSYY------ALKAA 192
            |:  .:.|||.|||    ..|.|:..|....:.|...   ::|..||:|||:||      |:|..
  Fly   136 KKNSQVSFLHVYHHGGMVFGVSIFMTFLGGSHCSMLG---IINLLVHTVMYAYYYAASLGAVKNL 197

  Fly   193 RFNPPRFISMIITSLQLAQMIIGCAINVWANGFLKTH-----GTSSCH----ISQRNINLSIAMY 248
            .:...|     ||.|||.|.           |:|..|     ..:.|.    |:......:|.|:
  Fly   198 LWWKQR-----ITQLQLMQF-----------GYLTFHFLLVIVRNPCQFPVFIAFIGFIQNIFMF 246

  Fly   249 SSYFVLFARFFYKAYLAPGGHKSRRMA 275
            |.:|    .|:.|.|:    .|.|:.|
  Fly   247 SMFF----DFYCKTYI----RKQRKSA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 70/281 (25%)
CG6660NP_651104.1 ELO 25..265 CDD:279492 72/285 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46589
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
87.900

Return to query results.
Submit another query.