DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and CG9459

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649958.2 Gene:CG9459 / 41213 FlyBaseID:FBgn0037764 Length:265 Species:Drosophila melanogaster


Alignment Length:279 Identity:70/279 - (25%)
Similarity:124/279 - (44%) Gaps:38/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YSYIFDFENDFIHQRTRKWMLENWTWVFYYCGIYMLVI-FGGQHFMQNRPRFQLRGPL------- 68
            ::::.||.|.......|..:..:...|....|||::.| ..|..||||:..:.|...:       
  Fly     2 FAHMLDFLNRSPPDPVRLPLTSSHWPVLTILGIYLVFIKIVGPWFMQNQKPYNLDRAIKIYNIVQ 66

  Fly    69 IIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSVCVPSYIEQDRVCGFW-TWL---FVLSKLPE 129
            |.:|.:|.:||           :|.:...|.::..|: |.:..|.....| .||   :..:||.:
  Fly    67 IAYNVILLIFS-----------VHFMLGPGNYNFSCI-SNLPLDHEYKNWERWLSYSYFFNKLMD 119

  Fly   130 LGDTIFIVLRK--QPLIFLHWYHHITVLIYSWFSYT---EYTSSARWFIVMNYCVHSVMYSYYAL 189
            |.:|:|.:.||  :.:.|||.:||: .::|..|.|.   .|.....:.|..|..||::||:||..
  Fly   120 LLETVFFIFRKKYRQISFLHVFHHV-YMVYIGFLYMYYYGYGGHGFFLITFNVVVHTMMYTYYYQ 183

  Fly   190 KAARFNP--PRFISMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSSYF 252
            .:...|.  ..:....||.:||.|.:|..:.:|:   .|:   .:.|..|:.:......:...:.
  Fly   184 SSLNRNSGGDLWWKKYITVVQLVQFVIIFSHSVY---ILR---QTDCQTSRLSATWGSLISVVFI 242

  Fly   253 VLFARFFYKAYLAPGGHKS 271
            :||:.|:.:.|:.|...||
  Fly   243 ILFSNFYVRTYILPKKTKS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 64/259 (25%)
CG9459NP_649958.2 ELO 20..261 CDD:279492 64/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46589
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.800

Return to query results.
Submit another query.