DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and elovl5

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_956747.1 Gene:elovl5 / 393425 ZFINID:ZDB-GENE-040407-2 Length:291 Species:Danio rerio


Alignment Length:261 Identity:71/261 - (27%)
Similarity:116/261 - (44%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RTRKW-MLENWTWVFYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWN---TLLAMFSIMGAART 86
            |...| :|:::...|.:..:|:|:::.|..:|:||..:..|..|:.:|   |||:::...     
Zfish    22 RVTGWFLLDDYIPTFIFTVMYLLIVWMGPKYMKNRQAYSCRALLVPYNLCLTLLSLYMFY----- 81

  Fly    87 APELIHVLRHYGLFHSVCVPSYIEQD---RVCGFWTWLFVLSKLPELGDTIFIVLRK--QPLIFL 146
              ||:..: :.|.::..|..::...|   |:... .|.:..|||.|..||.|.:|||  ..:.||
Zfish    82 --ELVMSV-YQGGYNFFCQNTHSGGDADNRMMNV-LWWYYFSKLIEFMDTFFFILRKNNHQITFL 142

  Fly   147 HWYHHITVLIYSWFSYTEYTSSARWF-IVMNYCVHSVMYSYYALKAA-RFNPPRFISMIITSLQL 209
            |.|||.|:|...||..........:| ...|..:|.:|||||.|.|. ...|..:....||..||
Zfish   143 HVYHHATMLNIWWFVMNWVPCGHSYFGATFNSFIHVLMYSYYGLSAVPALRPYLWWKKYITQGQL 207

  Fly   210 AQMII-----GCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSSYFVLFARFFYKAYLAPGGH 269
            .|.::     .||: ||..||           ....:...|:...:..:||:.|:.:.|....|.
Zfish   208 VQFVLTMFQTSCAV-VWPCGF-----------PMGWLYFQISYMVTLILLFSNFYIQTYKKRSGS 260

  Fly   270 K 270
            :
Zfish   261 R 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 70/257 (27%)
elovl5NP_956747.1 ELO 27..262 CDD:279492 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54116
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.