DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and CG17821

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster


Alignment Length:238 Identity:62/238 - (26%)
Similarity:109/238 - (45%) Gaps:35/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YMLVIFG-GQHFMQNRPRFQLRGPLIIWNTLLAMFS----IMGAARTAPELIHVLRHYGLFHSVC 104
            |:|:||. |..||::|..:.:|..::|:|....:.:    :||.     ..:.:.:.|. |..:.
  Fly    35 YLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGT-----YYLFIKKLYD-FRCMT 93

  Fly   105 VPSYIEQDR-VCGFWTWLFVLSKLPELGDTIFIVLRK--QPLIFLHWYHHITVLIYSWFSYTEYT 166
            :.|....|: |....|:.:.::|:.:|.||||.||||  :.:..||.|||:.:::....:|..|.
  Fly    94 MLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYYFYG 158

  Fly   167 SSARWFIV--MNYCVHSVMYSYYALKAARFNPPRFISMI-----ITSLQLAQMIIGCA---INVW 221
            ...::.::  :|..||.|||:||...|..   |...|..     ||.||..|.:|..|   :.:|
  Fly   159 PGGQYNLMGYLNSFVHVVMYAYYFASAWY---PNVKSTFWWKEYITKLQFLQFMILFAQSVLTLW 220

  Fly   222 ANGFLKTHGTSSCHISQRNINLSIAMYSSYFVLFARFFYKAYL 264
            .|        ..|...:....:.:....|...:|..|:|:.|:
  Fly   221 LN--------PGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 62/238 (26%)
CG17821NP_725820.2 ELO 20..262 CDD:279492 62/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473083
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46589
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.800

Return to query results.
Submit another query.