DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and Elovl7

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001178773.1 Gene:Elovl7 / 361895 RGDID:1310560 Length:281 Species:Rattus norvegicus


Alignment Length:277 Identity:77/277 - (27%)
Similarity:129/277 - (46%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LENWTWV------FYYCGIYMLVIFG-GQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPE 89
            :|||..:      ....|:|:..:.. |...|:||..|:|:..:|.:|..:.:||:.....    
  Rat    25 VENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYE---- 85

  Fly    90 LIHVLRHYGLFHSV-C-VPSYIEQDR------VCGFWTWLFVLSKLPELGDTIFIVLRKQ--PLI 144
              .|:..:|..:|. | :..|.:..|      .|    ||:..||..||.||||.||||:  .:.
  Rat    86 --FVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTC----WLYYFSKFIELFDTIFFVLRKKNSQVT 144

  Fly   145 FLHWYHHITVLIYSWFSYTEYTSS--ARWFIVMNYCVHSVMYSYYALKAARFNPPRFISMI---- 203
            |||.:|| |::.::|:...::.:.  ..:..::|..||.|||.||.|.|.   .|.:...:    
  Rat   145 FLHVFHH-TIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAM---GPAYQKYLWWKK 205

  Fly   204 -ITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAM-YSSYF-VLFARFFYKAYLA 265
             :|||||.|.:: ..:::....|::     .|:. |..:.|.|.| |...| :||..|:|:||. 
  Rat   206 HLTSLQLVQFVL-VTVHIGQIFFME-----DCNY-QYPVFLYIIMSYGCIFLLLFLHFWYRAYT- 262

  Fly   266 PGGHKSRRMAASLAAQN 282
                |.:|:..::...|
  Rat   263 ----KGQRLPKTMENGN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 74/264 (28%)
Elovl7NP_001178773.1 ELO 30..269 CDD:395916 73/264 (28%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.