DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and CG31141

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_732912.2 Gene:CG31141 / 318605 FlyBaseID:FBgn0051141 Length:253 Species:Drosophila melanogaster


Alignment Length:257 Identity:66/257 - (25%)
Similarity:111/257 - (43%) Gaps:67/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YMLVIF-GGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSVCVPSY 108
            |:||:| .|:.||::|..:.||..|..:|.....::||                     :.:|.|
  Fly    31 YLLVVFKAGRKFMEHREPYNLRKVLKYYNMFQIFYNIM---------------------MLLPGY 74

  Fly   109 ----------------IEQDRVCGFW----TWLFVLSKLPELGDTIFIVLRKQ--PLIFLHWYHH 151
                            ::||.....|    ::.:.::|:.:|.||:|.||||:  .:.|||.:||
  Fly    75 YFMLVFQPYNFRCMTVLQQDHPLKNWERCISYAYYINKIVDLLDTVFCVLRKKYSQITFLHVFHH 139

  Fly   152 ITV-----LIYSWFSYTEYTSSARWFIV-MNYCVHSVMYSYY--ALKAARFNPPRFISMIITSLQ 208
            :.:     ||..::.|    ....:|:. .|..||..||:||  |:|.......|::: ::..||
  Fly   140 VLMPSAGYLIIRFYGY----GGQLFFLCSFNVFVHIFMYAYYYSAIKGNTVRWKRYLT-LMQMLQ 199

  Fly   209 LAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSSYFVLFARFFYKAYLAPGGHK 270
            ...|...||:         |.....|..||..:.|.....:..|::||.|:::.||.| .||
  Fly   200 FLLMFGHCAL---------TAMQRQCTASQGTLFLVSCSATIMFIMFANFYFQCYLRP-KHK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 66/257 (26%)
CG31141NP_732912.2 ELO 34..253 CDD:279492 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
87.800

Return to query results.
Submit another query.