DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and Elovl4

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:304 Identity:85/304 - (27%)
Similarity:123/304 - (40%) Gaps:64/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QRTRKWMLENWTW-VFYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWN---TLLAMF----SIM 81
            :|...|.|....| ......:|:|.::.|..:|::|..||:|..|||:|   .||.:|    ..|
  Rat    35 KRVEDWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFM 99

  Fly    82 GAARTAPELIHVLRHYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQ--PLI 144
            |:.......|        ..||...:.:.:.|:.....|.|| ||..|..||:|.:|||:  .:.
  Rat   100 GSYNAGYSYI--------CQSVDYSNDVNEVRIAAALWWYFV-SKGVEYLDTVFFILRKKNNQVS 155

  Fly   145 FLHWYHHITVLIYSWFSYTEYTSSARWF-IVMNYCVHSVMYSYYALKAARFNP--------PRFI 200
            |||.|||.|:....|...........:| ..||..:|.:|||||.|.|  |.|        .|::
  Rat   156 FLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTA--FGPWIQKYLWWKRYL 218

  Fly   201 SMIITSLQLAQ--MIIG---------CAINVWANGFLKTHGTSSCHISQRNINLSIAMYSSYFVL 254
            :|    |||.|  :.||         |....|.:..|                  ||...|:..|
  Rat   219 TM----LQLVQFHVTIGHTALSLYTDCPFPKWMHWAL------------------IAYAISFIFL 261

  Fly   255 FARFFYKAYLAPGGHKSRRMAASLAAQNVVKQSSSPQQASESSK 298
            |..|:.:.|..|...|:.:.|.:..:.|.|.:|.. |...|:.|
  Rat   262 FLNFYTRTYNEPKKSKTGKTATNGISANGVNKSEK-QLVLENGK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 76/270 (28%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 75/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54116
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.