DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and CG30008

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster


Alignment Length:307 Identity:69/307 - (22%)
Similarity:123/307 - (40%) Gaps:110/307 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FYYCGIYMLVIF----GGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAAR-------------- 85
            :|...:.:|.::    .|.|||:.|..::|: .||:.:..:.:.|.:.|.:              
  Fly    23 WYMITVLVLYLYFVTKAGPHFMEWRKPYELK-RLILLHNFIQVVSCIYAIKEVLYITDNTIYIFW 86

  Fly    86 ------TAPELIHVLRHYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQ--P 142
                  ::|||:.  |:|.|.:               |..||    |:.||.:|:..||||:  .
  Fly    87 KCRDIGSSPELVR--RYYNLAY---------------FLFWL----KISELIETVIFVLRKKQNQ 130

  Fly   143 LIFLHWYHHIT--VLIYSWFSYTEYTSSARWFIVMNYCVHSVMYSYYALKAA-------RFNPPR 198
            :..||.:||.:  .|:|:..::.|..|:|.:.:.:|..||.:|||||.:.|.       ...|  
  Fly   131 VSKLHIFHHFSTVTLVYALINFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKTLVQALTP-- 193

  Fly   199 FISMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINL-------SIAMYSSYFVL-- 254
             :...||.:|:.|.::                    .::|....|       .:.:|.:..:|  
  Fly   194 -VKKCITVIQMTQFVL--------------------ILTQVAFQLVLCGMPPLVLLYFTTVILGM 237

  Fly   255 ---FARFFYKAYLAPGGHKSRRMAASLAAQNVVKQSSSPQQASESSK 298
               |..|:..||.|     |:|           ::|.:||  |:|.|
  Fly   238 FYGFYDFYNSAYQA-----SQR-----------RKSQTPQ--SDSKK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 61/278 (22%)
CG30008NP_724853.1 ELO 20..257 CDD:279492 63/294 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
76.900

Return to query results.
Submit another query.