DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and Elovl5

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:294 Identity:72/294 - (24%)
Similarity:108/294 - (36%) Gaps:82/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RTRKW-MLENWTWVFYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPE 89
            |.:.| :|:|:...|....||:|:::.|..:|:||..|..||.|:::|..|.:.|:         
  Rat    22 RVKGWFLLDNYIPTFVCSAIYLLIVWLGPKYMKNRQPFSCRGILVVYNLGLTLLSL--------- 77

  Fly    90 LIHVLRHYGLFHSVCVPSYIEQDRVCGFW------------------------TWLFVLSKLPEL 130
                              |:..:.|.|.|                        .|.:..|||.|.
  Rat    78 ------------------YMFYELVTGVWEGKYNFFCQGTRSAGESDMKVIRVLWWYYFSKLIEF 124

  Fly   131 GDTIFIVLRK--QPLIFLHWYHHITVLIYSWFSYTEYTSSARWF-IVMNYCVHSVMYSYYALKAA 192
            .||.|.:|||  ..:..||.|||.|:|...||..........:| ..:|..:|.:|||||.|.:.
  Rat   125 MDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV 189

  Fly   193 -RFNPPRFISMIITSLQLAQMII-----GCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSSY 251
             ...|..:....||..||.|.::     .|.: :|           .|......:...|....|.
  Rat   190 PSMRPYLWWKKYITQGQLVQFVLTIIQTSCGV-IW-----------PCSFPLGWLYFQIGYMISL 242

  Fly   252 FVLFARFFYKAYLAPG---------GHKSRRMAA 276
            ..||..|:.:.|...|         ||::..|.|
  Rat   243 IALFTNFYIQTYNKKGASRRKEHLKGHQNGSMTA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 69/283 (24%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 66/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54116
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.