DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Baldspot and elovl3

DIOPT Version :9

Sequence 1:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002935809.1 Gene:elovl3 / 100497108 XenbaseID:XB-GENE-977704 Length:270 Species:Xenopus tropicalis


Alignment Length:272 Identity:126/272 - (46%)
Similarity:164/272 - (60%) Gaps:28/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NMDISVTPNYSYIFDFENDFIHQRTRKWMLENWTWVFYYCGIYMLVIFGGQHFMQNRPRFQLRGP 67
            |:.:.:...|    |||..|..|...:||.|||:..|::..:|..:|||||..|:.|.||:||.|
 Frog     8 NLSVVLLQEY----DFERRFDDQGAIQWMQENWSKSFFFSLLYAALIFGGQRMMKERRRFELRRP 68

  Fly    68 LIIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSVCVPSYIEQDR------VCGFWTWLFVLSK 126
            |::|:..||:|||:||.||...:.::|...|...|||       ||      |..||.:.|||||
 Frog    69 LVLWSFTLAVFSIIGAVRTGWFMGNILITNGFKQSVC-------DRAFYSGPVSKFWAYAFVLSK 126

  Fly   127 LPELGDTIFIVLRKQPLIFLHWYHHITVLIYSWFSYTEYTSSARWFIVMNYCVHSVMYSYYALKA 191
            :||||||:|||||||.|||||||||||||:|:|::|.:..:...||:.|||.||:.|||||.|:|
 Frog   127 VPELGDTLFIVLRKQKLIFLHWYHHITVLLYTWYTYKDTVAGGGWFMTMNYTVHAFMYSYYTLRA 191

  Fly   192 ARFNPPRFISMIITSLQLAQMIIGCAINV----WANGFLKTHGTSSCHISQRNINLSIAMYSSYF 252
            |....||..:|.||..|:.||::|..:|.    |..       ..||..:..||..|..||.|||
 Frog   192 AGIRVPRPCAMFITFTQILQMVMGIVVNALVYSWRQ-------DGSCLSTTENIFWSCLMYFSYF 249

  Fly   253 VLFARFFYKAYL 264
            :||..|||||||
 Frog   250 ILFCSFFYKAYL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaldspotNP_648909.1 ELO 30..271 CDD:395916 119/245 (49%)
elovl3XP_002935809.1 ELO 31..262 CDD:366492 119/245 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 249 1.000 Domainoid score I2078
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I3086
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000936
OrthoInspector 1 1.000 - - otm47780
Panther 1 1.100 - - O PTHR11157
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.