DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mo25 and cab39l

DIOPT Version :9

Sequence 1:NP_001261958.1 Gene:Mo25 / 39858 FlyBaseID:FBgn0017572 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001017180.1 Gene:cab39l / 549934 XenbaseID:XB-GENE-953216 Length:337 Species:Xenopus tropicalis


Alignment Length:338 Identity:224/338 - (66%)
Similarity:284/338 - (84%) Gaps:5/338 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLFGKSQKSPVELVKSLKEAINALEAGDRKVEKAQEDVSKNLVSIKNMLYGSSDAEPPADYVVA 65
            ||||.||.|:|.|:||:||:.:..||..|:|.|||.|:|||:|.:.|.:|.|:.|.||..: .||
 Frog     4 MPLFSKSHKNPAEIVKTLKDNMAVLERQDKKTEKASEEVSKSLQATKEILCGTGDKEPQTE-TVA 67

  Fly    66 QLSQELYNSNLLLLLIQNLHRIDFEGKKHVALIFNNVLRRQIGTRSPTVEYICTKPEILFTLMAG 130
            ||:||||||.||:.||.|||.|||||||.|:.||||:|||||||||||||||.:...|||.|:.|
 Frog    68 QLAQELYNSGLLVTLIANLHLIDFEGKKDVSQIFNNILRRQIGTRSPTVEYISSHQHILFILLKG 132

  Fly   131 YEDAHPEIALNSGTMLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIASDAFSTFKELLTRHK 195
            ||.  |::||:.|.|||||.|:|.|||::::|::|..||:|||:||||||||||:|||:||||||
 Frog   133 YES--PQVALHCGIMLRECVRHEPLAKVIIYSEQFGDFFKYVEMSTFDIASDAFATFKDLLTRHK 195

  Fly   196 LLCAEFLDANYDKFFSQHYQRLLNSENYVTRRQSLKLLGELLLDRHNFTVMTRYISEPENLKLMM 260
            |:.||||:.|||:.|:. |::||:||||||:||||||||||:||||||::||:|||:||||||||
 Frog   196 LMVAEFLEQNYDRIFND-YEKLLHSENYVTKRQSLKLLGELILDRHNFSIMTKYISKPENLKLMM 259

  Fly   261 NMLKEKSRNIQFEAFHVFKVFVANPNKPKPILDILLRNQTKLVDFLTNFHTDRSEDEQFNDEKAY 325
            |:|::||.|||||||||||||||||||.:||:||||:|||||::||::|..:|::||||.|||.|
 Frog   260 NLLRDKSPNIQFEAFHVFKVFVANPNKTQPIVDILLKNQTKLIEFLSSFQKERTDDEQFTDEKNY 324

  Fly   326 LIKQIKEL-KPLP 337
            |||||::| ||.|
 Frog   325 LIKQIRDLKKPTP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mo25NP_001261958.1 Mo25 3..334 CDD:400746 219/331 (66%)
cab39lNP_001017180.1 Mo25 6..333 CDD:369961 218/330 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 444 1.000 Domainoid score I527
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 449 1.000 Inparanoid score I1584
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509368at33208
OrthoFinder 1 1.000 - - FOG0001165
OrthoInspector 1 1.000 - - otm47475
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R936
SonicParanoid 1 1.000 - - X720
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.