DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4101 and manbal

DIOPT Version :9

Sequence 1:NP_648908.1 Gene:CG4101 / 39857 FlyBaseID:FBgn0025558 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001289935.1 Gene:manbal / 795041 ZFINID:ZDB-GENE-161222-1 Length:88 Species:Danio rerio


Alignment Length:71 Identity:25/71 - (35%)
Similarity:39/71 - (54%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FSLLIRYGLYVGALFQFVCISAAVLM----ENNPDGQSNPESGEVTEREGE---PVRTRLHKIRK 80
            |..|:||||::||:||.:||.|.::.    ...|...|:|.....|::..:   ||:....|::|
Zfish    18 FESLLRYGLFLGAIFQLICILAVIIPTSKGHEQPVETSDPADTRSTDQNRKAKPPVQQIRQKMKK 82

  Fly    81 LEKKKR 86
            ..||||
Zfish    83 ESKKKR 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4101NP_648908.1 UPF0239 12..86 CDD:284251 23/69 (33%)
manbalNP_001289935.1 UPF0239 7..78 CDD:284251 19/59 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DWKT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597344at2759
OrthoFinder 1 1.000 - - FOG0008181
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110749
Panther 1 1.100 - - LDO PTHR14409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.