DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4101 and Manbal

DIOPT Version :9

Sequence 1:NP_648908.1 Gene:CG4101 / 39857 FlyBaseID:FBgn0025558 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_081244.2 Gene:Manbal / 69161 MGIID:1916411 Length:85 Species:Mus musculus


Alignment Length:67 Identity:22/67 - (32%)
Similarity:38/67 - (56%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LIRYGLYVGALFQFVCISAAVLMENNPDGQSNPESGEVTEREGEPVRTRL-----HKIRKLEKKK 85
            |:||||::||:||.:|: .|:::......::..|..|....|| |.:.::     :|..|.|.||
Mouse    21 LLRYGLFLGAIFQLICV-LAIIVPIPKSHEAEAEQAEPRSAEG-PKKPKVAIASTNKRPKKETKK 83

  Fly    86 RR 87
            :|
Mouse    84 KR 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4101NP_648908.1 UPF0239 12..86 CDD:284251 20/64 (31%)
ManbalNP_081244.2 UPF0239 7..74 CDD:369078 16/54 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..85 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DWKT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008181
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110749
Panther 1 1.100 - - LDO PTHR14409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.