powered by:
Protein Alignment CG4101 and Manbal
DIOPT Version :9
Sequence 1: | NP_648908.1 |
Gene: | CG4101 / 39857 |
FlyBaseID: | FBgn0025558 |
Length: | 87 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_081244.2 |
Gene: | Manbal / 69161 |
MGIID: | 1916411 |
Length: | 85 |
Species: | Mus musculus |
Alignment Length: | 67 |
Identity: | 22/67 - (32%) |
Similarity: | 38/67 - (56%) |
Gaps: | 7/67 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LIRYGLYVGALFQFVCISAAVLMENNPDGQSNPESGEVTEREGEPVRTRL-----HKIRKLEKKK 85
|:||||::||:||.:|: .|:::......::..|..|....|| |.:.:: :|..|.|.||
Mouse 21 LLRYGLFLGAIFQLICV-LAIIVPIPKSHEAEAEQAEPRSAEG-PKKPKVAIASTNKRPKKETKK 83
Fly 86 RR 87
:|
Mouse 84 KR 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167845919 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2DWKT |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0008181 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_110749 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR14409 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
7 | 6.700 |
|
Return to query results.
Submit another query.