DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4101 and Manbal

DIOPT Version :9

Sequence 1:NP_648908.1 Gene:CG4101 / 39857 FlyBaseID:FBgn0025558 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001166851.1 Gene:Manbal / 499934 RGDID:1561447 Length:85 Species:Rattus norvegicus


Alignment Length:68 Identity:24/68 - (35%)
Similarity:38/68 - (55%) Gaps:10/68 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LIRYGLYVGALFQFVCISAAVL-------MENNPDGQSNPESGEVTEREGEPVRTRLHKIRKLEK 83
            |:||||::||:||.:|:.|.::       .|..|   |.|.|.||.::...|:.:...:.:|..|
  Rat    21 LLRYGLFLGAIFQLICVLAIIVPIPKSQEAEAEP---SEPRSAEVPKKPKAPIPSTNKRPKKETK 82

  Fly    84 KKR 86
            |||
  Rat    83 KKR 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4101NP_648908.1 UPF0239 12..86 CDD:284251 22/66 (33%)
ManbalNP_001166851.1 UPF0239 7..72 CDD:399634 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DWKT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597344at2759
OrthoFinder 1 1.000 - - FOG0008181
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110749
Panther 1 1.100 - - LDO PTHR14409
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.