DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and PUP3

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_011020.3 Gene:PUP3 / 856830 SGDID:S000000896 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:67/222 - (30%)
Similarity:101/222 - (45%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PYESNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSI 88
            |...|||.:||:.|.|...||.|.||.|.....|....|:|... ...||..|...|..:|....
Yeast     4 PSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYG-HVFLGITGLATDVTTLNEMF 67

  Fly    89 KVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPYYVSNILAGIDNE-GKGVVYSYDPIGHCEK 152
            :.:...|:....|.:..|...|::|.::|.|||.||:|..::|||::: ||..:..:|.||..::
Yeast    68 RYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDE 132

  Fly   153 A-TYRAGGTAG--------TLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERD 208
            | .:...|||.        :|.:|           |||..|..:        ..|...::||:||
Yeast   133 AKDFIVSGTASDQLFGMCESLYEP-----------NLEPEDLFE--------TISQALLNAADRD 178

  Fly   209 IYTGDSVLINIITKDGIEVRTLTLRQD 235
            ..:|...::.||.||.:..|.|.:|||
Yeast   179 ALSGWGAVVYIIKKDEVVKRYLKMRQD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 65/220 (30%)
PRE1 24..225 CDD:223711 62/210 (30%)
PUP3NP_011020.3 proteasome_beta_type_3 8..201 CDD:239728 62/212 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.