DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and PRE2

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:51/224 - (22%)
Similarity:97/224 - (43%) Gaps:23/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQFPDYQVPGMKHPDFSPYESNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSP--- 68
            :||........::||.....::|.:.:|.......::|.|:|.::|..:.|:|..|:.:::|   
Yeast    53 QQFLRAHTDDSRNPDCKIKIAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLL 117

  Fly    69 -QTVLGSAGC--WADTLSLTGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPYYVSNIL 130
             ....|:|.|  |...|   ||   :.:.:|......::..|.:::||..:|..:.....:..::
Yeast   118 GTMAGGAADCQFWETWL---GS---QCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMI 176

  Fly   131 AGIDNEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVS 195
            .|...:....:|..|..|...|......|:..|....|||:..           |..|:.|.|:.
Yeast   177 CGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNY-----------KWDLSVEDALY 230

  Fly   196 VASDTFISAAERDIYTGDSVLINIITKDG 224
            :...:.::||.||.|:|.||.:..:|:||
Yeast   231 LGKRSILAAAHRDAYSGGSVNLYHVTEDG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 47/209 (22%)
PRE1 24..225 CDD:223711 47/207 (23%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 46/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.