DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and PRE5

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:44/205 - (21%)
Similarity:72/205 - (35%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93
            |...|.:..:..||:.|   |....:..|..|.|:.|......|..||...|...|:..::.:..
Yeast    32 GSVTVGLRSNTHAVLVA---LKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCN 93

  Fly    94 SYEHTHLRTMTTEAVAQML------SIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEK 152
            .......|.:..|....:|      :...|..|  ||.|..::.|.|..|..:: .:.|.|:..:
Yeast    94 YSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGR--PYGVGLLIIGYDKSGAHLL-EFQPSGNVTE 155

  Fly   153 ATYRAGGT----AGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGD 213
            ....|.|.    |.|.|:..||..|           ||....:..:....:....:...:..|.|
Yeast   156 LYGTAIGARSQGAKTYLERTLDTFI-----------KIDGNPDELIKAGVEAISQSLRDESLTVD 209

  Fly   214 SVLINIITKD 223
            ::.|.|:.||
Yeast   210 NLSIAIVGKD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 44/205 (21%)
PRE1 24..225 CDD:223711 44/205 (21%)
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:412394 42/201 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.