DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and PUP1

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_014800.3 Gene:PUP1 / 854328 SGDID:S000005683 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:59/221 - (26%)
Similarity:103/221 - (46%) Gaps:32/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVR 91
            |.|.:||.:..::..|||||||.:.|..:..:..:||.::||:.....||..|||.::|..|...
Yeast    27 STGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSN 91

  Fly    92 MQSYEHTHLRTMTTEAVAQMLS-IAMYNRRFFPY------YVSNILAGIDNEGKGVVYSYDPIGH 149
            ::      |.::.|....:::| :.|..:..|.|      |:  |:||:|..|.. ::|....|.
Yeast    92 IE------LHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYL--IVAGVDPTGSH-LFSIHAHGS 147

  Fly   150 CEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDS 214
            .:...|.:.|:.......||::..           |..||||.|:.:|||...:....|:.:|.:
Yeast   148 TDVGYYLSLGSGSLAAMAVLESHW-----------KQDLTKEEAIKLASDAIQAGIWNDLGSGSN 201

  Fly   215 VLINI--ITKDGIEVR---TLTLRQD 235
            |.:.:  |.||...:|   |..:|::
Yeast   202 VDVCVMEIGKDAEYLRNYLTPNVREE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 59/219 (27%)
PRE1 24..225 CDD:223711 56/206 (27%)
PUP1NP_014800.3 proteasome_beta_type_7 30..219 CDD:239732 55/208 (26%)
Pr_beta_C 223..257 CDD:403609 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.