DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and PRE9

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_011651.3 Gene:PRE9 / 853036 SGDID:S000003367 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:59/229 - (25%)
Similarity:96/229 - (41%) Gaps:45/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FSP----YE--------SNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGS 74
            |||    |:        |:.|:.:.|...|..|:||:.:::|.......:..||:||:.:..:..
Yeast    13 FSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAV 77

  Fly    75 AGCWADTLSLTGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAM--YNRR--FFPYYVSNILAGIDN 135
            ||..||...|..:.::..|:|..|:...:..|.:.:.||...  |.:.  ..|:.||.|.||.|:
Yeast    78 AGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142

  Fly   136 EGKGVVYSYDPIGHCE--KATYRAGGT--AGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSV 196
            .....:|:.:|.|:..  ||......|  |.||||           |:.:|..|:....|.|:..
Yeast   143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ-----------MDYKDDMKVDDAIELALKT 196

  Fly   197 ASDTFISAAERDIYTGDSVLINIITKDGIEVRTL 230
            .|.|..|:|              :|.|.:|..|:
Yeast   197 LSKTTDSSA--------------LTYDRLEFATI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 59/229 (26%)
PRE1 24..225 CDD:223711 55/220 (25%)
PRE9NP_011651.3 proteasome_alpha_type_4 4..216 CDD:239721 58/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.