DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and SCL1

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_011504.3 Gene:SCL1 / 852873 SGDID:S000002979 Length:252 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:43/220 - (19%)
Similarity:84/220 - (38%) Gaps:30/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYEH 97
            :|:.|.|..|:.:..::.... :...|.|.:|.:|....:...|...|..:.....|.....:.:
Yeast    43 LAVRGKDCTVVISQKKVPDKL-LDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRY 106

  Fly    98 THLRTMTTEAVAQMLS--IAMYNRRFF--PYYVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAG 158
            .:...|..:.:|:.::  ..:|.:|.:  |..|......:|.|....:|..||.|:  ...|:|.
Yeast   107 KYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGY--YVGYKAT 169

  Fly   159 GTAGTLLQPVLDNQIGH------KNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLI 217
            .| |...|.:..|...|      .::|.|..:|:       |..|....|.|...: ::.:.:.:
Yeast   170 AT-GPKQQEITTNLENHFKKSKIDHINEESWEKV-------VEFAITHMIDALGTE-FSKNDLEV 225

  Fly   218 NIITKD--------GIEVRTLTLRQ 234
            .:.|||        .||.|.:.:.:
Yeast   226 GVATKDKFFTLSAENIEERLVAIAE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 43/220 (20%)
PRE1 24..225 CDD:223711 40/209 (19%)
SCL1NP_011504.3 proteasome_alpha_type_6 12..228 CDD:239723 37/196 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.