DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Psmb11

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_780413.1 Gene:Psmb11 / 73902 MGIID:1921152 Length:302 Species:Mus musculus


Alignment Length:244 Identity:56/244 - (22%)
Similarity:91/244 - (37%) Gaps:44/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QFPDYQVPGMKHPD------------------FSPYESNGGSIVAIAGDDFAVIAADTRLSSGYN 54
            |.||...|.:..|.                  ..|..::|.:.:|.......:.|||||.|.|..
Mouse    10 QTPDTPRPSIHLPQAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSY 74

  Fly    55 IHSRTQSKLFKLSPQTVLG-----SAGC--WADTLSLTGSIKVRMQSYEHTHLRTMTTEAVAQML 112
            :......|:..:. |.:||     ||.|  |...|..    ::|::......|.::.  ..|::|
Mouse    75 VACPASRKVIPVH-QRLLGTTSGTSADCATWYRVLRR----ELRLRELREGQLPSVA--GTAKLL 132

  Fly   113 SIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKN 177
            :..|...|.....|:..|.|.|:.|..:.|.|.. |.|.:....:.|:.......|||... |.:
Mouse   133 AAMMSCYRGLDLCVATALCGWDHSGPALFYVYSD-GTCLQGDIFSVGSGSPYAYGVLDRGY-HYD 195

  Fly   178 MNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITKDGIE 226
            |.:::          |.::|......|..||.|:|.||.:..:.:.|.|
Mouse   196 MTIQE----------AYTLARCAVAHATHRDAYSGGSVDLFHVRESGWE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 51/212 (24%)
PRE1 24..225 CDD:223711 49/207 (24%)
Psmb11NP_780413.1 20S_bact_beta 48..253 CDD:163402 50/206 (24%)
proteasome_beta_type_5 50..237 CDD:239730 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.