Sequence 1: | NP_524115.1 | Gene: | Prosbeta6 / 39855 | FlyBaseID: | FBgn0002284 | Length: | 235 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571752.2 | Gene: | psmb13a / 64280 | ZFINID: | ZDB-GENE-001208-2 | Length: | 281 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 49/206 - (23%) |
---|---|---|---|
Similarity: | 87/206 - (42%) | Gaps: | 29/206 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93
Fly 94 SYEHTHLR----TMTTEAVAQMLSIAMYNRRFFPYY----VSNILAGIDNEGKGVVYSYDPIGHC 150
Fly 151 EKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSV 215
Fly 216 LINIITKDGIE 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta6 | NP_524115.1 | proteasome_beta_type_1 | 22..235 | CDD:239726 | 49/206 (24%) |
PRE1 | 24..225 | CDD:223711 | 48/203 (24%) | ||
psmb13a | NP_571752.2 | proteasome_beta_type_7 | 45..233 | CDD:239732 | 48/205 (23%) |
Pr_beta_C | 241..272 | CDD:315191 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |