DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and psmb13a

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:206 Identity:49/206 - (23%)
Similarity:87/206 - (42%) Gaps:29/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93
            |.:|..:...|..|:.||||.:|...:..:..:|:..::|......||..|||...|..:...:.
Zfish    44 GTTIAGVVFKDGVVLGADTRATSDEVVADKMCAKIHYIAPNIYCCGAGTAADTEKTTDMLSSNLT 108

  Fly    94 SYEHTHLR----TMTTEAVAQMLSIAMYNRRFFPYY----VSNILAGIDNEGKGVVYSYDPIGHC 150
            .:.....|    .|....:..||         |.|:    .:.||.|:|..|.. :|:..|.|..
Zfish   109 IFSMNSGRNPRVVMAVNIIQDML---------FRYHGMIGANLILGGVDCTGSH-LYTVGPYGSM 163

  Fly   151 EKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSV 215
            :|..|.|.|:.......:           |||..|:.:..|:|.::.||...:....|:.:|:::
Zfish   164 DKVPYLAMGSGDLAAMGI-----------LEDRFKVNMDLEQAKALVSDAIQAGIMCDLGSGNNI 217

  Fly   216 LINIITKDGIE 226
            .:.:|||:|::
Zfish   218 DLCVITKEGVD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 49/206 (24%)
PRE1 24..225 CDD:223711 48/203 (24%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 48/205 (23%)
Pr_beta_C 241..272 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.